Interferon γ (IFN γ) can also be called as IFG, IFI, IMD69.
Specifications Of P01I0001 Human IFN γ Protein, Recombinant
Porduct's Information | |
Catalog Number | P01I0001 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | IFG; IFI; IMD69 |
Protein & NCBI Number | P01579, NM_000619.3 |
Host | E.coli |
Express Region | 1-166aa |
Protein Length | The total length of the protein(including Tag) |
Protein Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSD VADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFR GRRASQ |
Molecular Weight | about 19.3kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute the Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IFNG gene encodes a soluble cytokine that is a member of the type II interferon class. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. It has the functions of anti-virus, affecting cell growth and differentiation, anti-tumor, anti parasite and immune regulation. Interferon- γ (interferon-gamma, IFN- γ) It is a cytokine mainly secreted by activated T cells and NK cells under the stimulation of mitogen and specific antigen. It is also a soluble glycoprotein, heat-resistant and acid, which is unstable at pH = 2. IFN- γ It can not only affect the cellular functions including anti-virus, anti swelling, cancer cell growth and differentiation, but also play an important role in immune regulation, such as promoting the synthesis of rRNA, promoting the expression of class I and class II histocompatibility antigens, and regulating the functional activity of homologous K cells, NK cells and macrophages. IFN- γ It also has antiviral activity, which is lower than type I, but it has strong immune regulation and anti cell proliferation, so it is also called immune interferon. |