En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01F0003P-T Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant

  • Cardiovascular
  • Signal Transduction
  • Neuroscience
  • Stem Cells
  • Cancer
  • Developmental Biology

Fibroblast Growth Factor 2 (FGF2) can also be called BFGF; FGFB; FGF-2; HBGF-2.

Products

Specifications Of P01F0003P-T Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant

Product Information

catalog number

P01F0003P-T

Package Size

10ug/50ug/500ug/1mg

Other Names

BFGF; FGFB; FGF-2; HBGF-2

Protein & NCBI Number

D9ZGF5, NM_001361665.2

Host

E.coli

Express Region

Met1-Ser155

Protein Sequence

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIH

PDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECF

FFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Weight

The protein consists of 281 amino acids (including the fusion tag), with a predicted
molecular weight of 31.5 kDa, which matches the actual molecular weight.

Fusion Tag

6×His-SUMO (N-terminus)

Purity

≥95% SDS-PAGE

Physical Property

Liquid

components

0.01M PBS+20% glycerol, sterile solution.

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6 months
at -20°C to -80°C, avoiding repeated freeze-thaw cycles.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and
interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products

Bioactivity
HuFGF2_有标(1).jpgHuFGF2_有标(1).jpgHuFGF2_有标(3).jpg



Background

FGF-2, also known as basic fibroblast growth factor (bFGF), is an important member of fibroblast growth factor (FGF) family. FGF-2 is a cationic polypeptide with a molecular weight of 16 ~ 18000 and an isoelectric point of 9.6. FGF2 can be produced by vascular endothelial cells, retinal pigment epithelial cells, photoreceptor cells, m ü ller cells and astrocytes. It widely exists in a variety of tissues in vivo and mainly plays a role through autocrine and paracrine. The signal pathway induced by FGF2 is necessary for normal cell growth and differentiation. It exists in almost all cells. FGF2 binds to FGFR, which makes the receptor dimerize and tyrosine kinase is activated, triggering a series of intracellular phosphorylation cascade reactions to regulate cell growth Differentiation and apoptosis. Under normal conditions, FGF-2 binds to heparin and does not produce biological effects. However, in some pathological cases, the integrity of cells is destroyed, which can release the stored form of FGF-2, promote angiogenesis and participate in the process of tissue repair. FGF-2 and FGFR are almost distributed in various tissues of the whole body. FGF-2 is the strongest known cytokine. It plays an important role in promoting angiogenesis, wound healing, tissue injury repair, neuroprotection, embryonic development and tumor formation. FGF-2 has two main functions, inducing endothelial cell germination and proliferation and increasing vascular permeability. In addition, studies have shown that FGF2 is also closely related to depression.


BlueGene Biotech Product Show

Related Products Of Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant

P01V0016P-T Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant

P01E0032P Human Epidermal Growth Factor (EGF) Protein, Recombinant

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.