Long arginine 3-IGF-1 (IGF1-LR3) can also be called Mechano growth factor (MGF),Somatomedin-C,IGF1,IGF-I,IGF1A,IGFI
Specifications Of P01I0420P-T Human Long arginine 3-IGF-1 (IGF1-LR3) Protein,Recombinant
Product Information | |
catalog number | P01I0420P-T |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | Mechano growth factor (MGF), Somatomedin-G, IGF1, IGF-I, IGF1A, IGFI |
Protein & NCBI Number | P05019 |
Host | E.coli |
Express Region | Gly49-Ala118 |
Protein Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYC |
Molecular Weight | The protein molecule consists of 191 amino acids (including the fusion tag), |
Fusion Tag | 6xHis-SUMO (N-terminus) |
Purity | ≥85% SDS-PAGE |
Physical Property | liquid |
Components | 0.01M PBS+20% glycerol, sterile solution. |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Insulin-like Growth Factor 1 (IGF-1), also known as somatomedin C, is a protein encoded by the human gene IGF1. Due to its unregulated insulin-like activity, it is also referred to as nonsuppressible insulin-like activity (NSILA). The IGF-1 protein consists of a single peptide chain composed of 70 amino acid residues and three intramolecular disulfide bonds, with a molecular weight of 7,649 daltons, and it can be secreted into the extracellular space. Originally isolated from plasma, it shares structural and functional similarities with insulin but possesses greater growth-promoting activity. It stimulates glucose transport in osteoblasts and is more efficient than insulin in DNA and glycogen synthesis and uptake. It acts as a ligand for IGF1R, binding to its α subunit and initiating tyrosine phosphorylation on tyrosine residues of the β subunit of tyrosine kinase, thereby activating downstream PI3K-AKT/PKB and Ras-MAPK pathways. |
BlueGene Biotech Product Show
Related Products Of Human Long arginine 3-IGF-1 (IGF1-LR3) Protein,Recombinant
P01I0345P-T Human Interferon gamma (IFNγ) Protein, Recombinant
P01R0005P-T Human Receptor activator of nuclear factor kappa B ligand (RANKL) Protein, Recombinant