Stem Cell Factor (SCF) can also be called SF; MGF; SCF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; WS2F; SHEP7; DFNA69.
Specifications Of P01S0011P-T Human Stem Cell Factor (SCF) Protein, Recombinant
Product Information | |
catalog number | P01S0011P-T |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | SF; MGF; SCF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; WS2F; SHEP7; DFNA69 |
Protein & NCBI Number | P21583 |
Host | E.coli |
Express Region | Met1-Ala189 |
Protein Sequence | MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFF |
Molecular Weight | The protein consists of 310 amino acids (including the fusion tag), with a predicted molecular weight of 35.15kDa |
Fusion Tag | SUMO (N-terminus), 6×His (C-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc |
Lead Time | 5 to 10 business days 2 to 3 days for stock products |
Background |
The Stem Cell Factor (SCF), also known as c-kit ligand (KL), steel factor (SLF), and mast cell growth factor (MGF), is a 30 kDa glycoprotein with a broad range of activities in various tissues, including hematopoietic cells, pigment cells, and primordial germ cells. While SCF has low biological activity when used alone, it exhibits strong synergistic effects when combined with other cytokines. Recombinant human Stem Cell Factor (rhSCF) is a hematopoietic growth factor that exerts its activity by signaling through the c-Kit receptor. SCF and c-Kit are crucial for the survival, proliferation, and differentiation of hematopoietic cells in the melanocyte and germ cell lineages. The action of Stem Cell Factor (SCF) is species-specific; human SCF has minimal effect on mouse bone marrow cells, with an activity that is only one-eight hundredth that of mouse SCF. Therefore, mice and rats cannot be used for pharmacodynamic and toxicological experiments of recombinant human SCF. In contrast, mouse SCF does have an effect on human bone marrow cells, but a significantly higher dose than human SCF is required to produce a noticeable effect. |
BlueGene Biotech Product Show
Related Products Of Human Stem Cell Factor (SCF) Protein, Recombinant
P01V0016P-T Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant
P01F0003P-T Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant