En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01E0032-H Human Epidermal Growth Factor (EGF) Protein,Recombinant

  • Cell Biology
  • Signal Transduction
  • Cancer

Epidermal Growth Factor (EGF) can also be called Pro-epidermal growth factor, EGF.

Products

Specifications Of P01E0032-H Human Epidermal Growth Factor (EGF) Protein,Recombinant


Product Information

catalog number

P01E0032-H

Package Size

10ug/50ug/500ug/1mg

Other Names

Pro-epidermal growth factor, EGF

Protein & NCBI Number

NM_001963.6

Host

E.coli 

Express Region

Asn971-Arg1023

Protein Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight

The protein consists of 174 amino acids (including the fusion tag), with a predicted molecular weight of 19.9kDa and an actual molecular weight of approximately 21kDa.

Fusion Tag

6×xHis-SUMO (N-terminus)

Purity

≥90% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution

Storage & Stability

 After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc

Lead Time

5 to 10 business days

2 to 3 days for stock products



Background

Human epidermal growth factor (EGF) is a 6-kDa protein with 53 amino acid residues and three intramolecular disulfide bonds. By binding to the homologous receptor EGFR on the cell surface, EGF can stimulate cell growth, differentiation, and survival. EGF stimulates the growth of various epidermal and epithelial tissues both in vivo and in vitro, and it also stimulates the growth of some fibroblasts in cell culture. This stimulation leads to ligand-induced dimerization, which activates the intrinsic protein tyrosine kinase activity of the receptor.

The tyrosine kinase activity, in turn, initiates a signaling cascade that results in a variety of biochemical changes within the cell: an increase in intracellular calcium levels, an increase in glycolysis and protein synthesis, an increase in the expression of certain genes (including the EGFR gene), and ultimately, DNA synthesis and cell proliferation.

EGF was initially described as a secretory peptide found in mouse submandibular glands and human urine. Subsequently, EGF has been found in many human tissues and fluids, including platelets, urine, saliva, milk, tears, plasma, submandibular glands, and parotid glands. Initially, human EGF was referred to as urogastrone.


BlueGene Biotech Product Show

Related Products Of Human Epidermal Growth Factor (EGF) Protein,Recombinant

P01V0016 Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant

P01F0003 Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant


Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.