Interleukin-6 (IL-6) can also be called CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
Specifications Of P01I0006P-T Human Interleukin-6 (IL-6) Protein, Recombinant
Product Information | |
catalog number | P01I0006P-T |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2 |
Protein & NCBI Number | P05231 |
Host | E.coli |
Express Region | Met1-Met212 |
Protein Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISA LRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQ NRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTT HLILRSFKEFLQSSLRALRQM |
Molecular Weight | The protein consists of 338 amino acids (including the fusion tag), with a predicted |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IL-6 gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including susceptibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). |
BlueGene Biotech Product Show
Related Products Of Human Interleukin-6 (IL-6) Protein, Recombinant
P01I0007P-T Human Interleukin 4 (IL-4) Protein, Recombinant
P01I0010P-T Human Interleukin 1β (IL-1β) Protein, Recombinant
P01I0023P-T Human Interleukin 10 (IL-10) Protein, Recombinant
P01I0056P-T Human Interleukin 8 (IL-8) Protein, Recombinant
P01I0308P-T Human Interleukin 2 (IL 2) Protein, Recombinant