P01I0010 Human Interleukin 1β (IL-1β) Protein, Recombinant

BlueGene Biotech P01I0010 Human Interleukin 1β (IL-1β) Protein, Recombinant

Immunology

Cancer

Interleukin 1β (IL-1β) can also be called IL-1; IL1F2; IL1beta; IL1-BETA

Specifications Of P01I0010 Human Interleukin 1β (IL-1β) Protein, Recombinant

catalog number	P01I0010
Package Size	10ug/50ug/100ug/1mg
Other Names	IL-1; IL1F2; IL1beta; IL1-BETA
Protein & NCBI Number	P01584, NM_000576.3
Host	E.coli
Express Region	Met1-Ser269
Protein Sequence	MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular Weight	The protein molecule consists of 395 amino acids (including the fusion tag), with a predicted molecular weight of 45.1 kDa and an actual molecular weight of 47-50 kDa.
Fusion Tag	6×His-SUMO (N-terminus)
Purity	≥60% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin IL-1β also known as catabolin, is a member of the interleukin 1 cytokine family. IL1B, the cytokine encoded by the IL1B gene, is an inflammatory response and fever mediator, and contributes to several lymphocyte activities including growth and differentiation of B-cells, proliferation of T-helper Type2 (Th2) clones, and activation of Th17 cells. IL-1β is produced in peripheral blood mononuclear cells, tissue macrophages, and dendritic fine cells in response to immune responses, inflammation, infection, and trauma cells such as cytium. IL1B is required for T-cell activation in some immune responses, and thus could contribute to increased T-cell replication. IL-1β can also act on distant target cells in an endocrine manner to induce systemic immune response. IL-1β can rapidly induce the expression of cytokines such as IL-6 and IL-8 of various cell types. At the same time, IL-1β also induces its own expression, forming a positive feedback loop and amplifying the IL-1 response.