Interleukin 1β (IL-1β) can also be called IL-1; IL1F2; IL1beta; IL1-BETA
Specifications Of P01I0010 Human Interleukin 1β (IL-1β) Protein, Recombinant
catalog number | P01I0010 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | IL-1; IL1F2; IL1beta; IL1-BETA |
Protein & NCBI Number | P01584, NM_000576.3 |
Host | E.coli |
Express Region | Met1-Ser269 |
Protein Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Molecular Weight | The protein molecule consists of 395 amino acids (including the fusion tag), with a predicted molecular weight of 45.1 kDa and an actual molecular weight of 47-50 kDa. |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥60% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Interleukin IL-1β also known as catabolin, is a member of the interleukin 1 cytokine family. IL1B, the cytokine encoded by the IL1B gene, is an inflammatory response and fever mediator, and contributes to several lymphocyte activities including growth and differentiation of B-cells, proliferation of T-helper Type2 (Th2) clones, and activation of Th17 cells. IL-1β is produced in peripheral blood mononuclear cells, tissue macrophages, and dendritic fine cells in response to immune responses, inflammation, infection, and trauma cells such as cytium. IL1B is required for T-cell activation in some immune responses, and thus could contribute to increased T-cell replication. IL-1β can also act on distant target cells in an endocrine manner to induce systemic immune response. IL-1β can rapidly induce the expression of cytokines such as IL-6 and IL-8 of various cell types. At the same time, IL-1β also induces its own expression, forming a positive feedback loop and amplifying the IL-1 response. |
BlueGene Biotech Product Show
Related Products Of Human Interleukin 1β (IL-1β) Protein, Recombinant
P01I0023 Human Interleukin 10 (IL-10) Protein, Recombinant
P01I0056 Human Interleukin 8 (IL-8) Protein, Recombinant
P01I0308 Human Interleukin 2 (IL 2) Protein, Recombinant
P01I0006 Human Interleukin-6 (IL-6) Protein, Recombinant
P01I0007 Human Interleukin 4 (IL-4) Protein, Recombinant