Interleukin 10 (IL-10) can also be called CSIF; TGIF; GVHDS; IL-10; IL10A
Specifications Of P01I0010 Human Interleukin 1β (IL-1β) Protein, Recombinant
catalog number | P01I0023 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | CSIF; TGIF; GVHDS; IL-10; IL10A |
Protein & NCBI Number | P22301 |
Host | E.coli |
Express Region | Met1-Asn178 |
Protein Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDL RDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQD PDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSE FDIFINYIEAYMTMKIRN |
Molecular Weight | The protein consists of 304 amino acids (including the fusion tag), with a predicted molecular weight of 34.8kDa, which matches the actual molecular weight. |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥75% Non-reducing SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution. |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IL-10 is composed of 178 amino acids, produced by B cells, Th1, Th2 and other adaptive immune cells.IL-10 activates a wide range of macrophage/monocyte functions, including the synthesis of monocyte factors, NO production, and the expression of major histocompatibility complex class Ⅱ (MHC Ⅱ) costimulatory molecules such as IL-12 and CD80/CD86. The inhibitory effect of IL-10 on IL-1 and TNF is key to its anti-inflammatory activity, as these two cytokines often have synergistic effects on inflammatory pathways and processes, expanding the inflammatory response through secondary mediators such as chemokines, PGs, and PAF. Regulating the inflammatory response in the context of constant stress is important for a living organism. IL-10 is a multifunctional cytokine that regulates the function of hematopoietic cells. |
BlueGene Biotech Product Show
Related Products Of Human Interleukin 10 (IL-10) Protein, Recombinant
P01I0056 Human Interleukin 8 (IL-8) Protein, Recombinant
P01I0308 Human Interleukin 2 (IL 2) Protein, Recombinant
P01I0006 Human Interleukin-6 (IL-6) Protein, Recombinant
P01I0007 Human Interleukin 4 (IL-4) Protein, Recombinant
P01I0010 Human Interleukin 1β (IL-1β) Protein, Recombinant