Interleukin 18 (IL-18) can also be called IGIF; IL-18; IL-1g; IL1F4
Specifications Of P01I0310 Human Interleukin 18 (IL-18) Protein, Recombinant
Product Information | |
catalog number | P01I0310 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | IGIF; IL-18; IL-1g; IL1F4 |
Protein & NCBI Number | Q14116, NM_001562 |
Host | E.coli |
Express Region | Met1-Asp193 |
Protein Sequence | MGSSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLME |
Molecular Weight | The protein consists of 306 amino acids (including the fusion tag), with a |
Fusion Tag | SUMO(N-terminus), 6×His (C-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Interleukin-18 belongs to the interleukin-1 family. Interleukin 18 (IL-18) is a potent pro-inflammatory cytokine that can induce the production of interferon-γ (IFN-γ) by Th1 cells, natural killer (NK) cells, and activated macrophages, particularly in the presence of IL-12. IL-18 also participates in regulating the development of T lymphocyte helper type I cells and Fas-mediated cytotoxicity. Inhibition of IL-18 activity is being investigated as a therapeutic approach for the treatment of chronic inflammatory diseases such as Crohn's disease and rheumatoid arthritis. It operates by inducing heterodimerization of its receptors, IL-18RAlpha and IL-18RBeta, which is structurally similar to IL-1. The regulatory mechanism of Interleukin-18 is very complex, and its production is modulated by a variety of signaling pathways. Cytokines such as Tumor Necrosis Factor (TNF) and Interleukin (IL-1) can stimulate the production of interleukin-18. Additionally, the Toll-like receptor (TLR) signaling pathway and the NLRP3 Inflammasome are also involved in the regulation of Interleukin-18. Furthermore, certain transcription factors, such as NF-κB and AP-1, can directly or indirectly influence the production of interleukin-18. |
BlueGene Biotech Product Show
Related Products Of Human Interleukin 18 (IL-18) Protein, Recombinant
P01I0420 Human Long arginine 3-IGF-1 (IGF1-LR3) Protein,Recombinant
P01I0345 Human Interferon gamma (IFNγ) Protein, Recombinant