Interferon gamma (IFNγ) can also be called IFG; IFI; IMD69
Specifications Of P01I0345 Human Interferon gamma (IFNγ) Protein, Recombinant
| Product Information | |
Catalog Number | P01I0345 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | IFG; IFI; IMD69 |
Protein & NCBI Number | P01579、NM_000619.3 |
Host | E.coli |
Express Region | Met1-Gln166 |
Protein Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSD VADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFR GRRASQ |
Molecular Weight | The protein consists of 292 amino acids (including the fusion tag), with a predicted |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution. |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IFNG gene encodes a soluble cytokine that is a member of the type II interferon class. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. It has the functions of anti-virus, affecting cell growth and differentiation, anti-tumor, anti parasite and immune regulation. Interferon- γ (interferon-gamma, IFN- γ) It is a cytokine mainly secreted by activated T cells and NK cells under the stimulation of mitogen and specific antigen. It is also a soluble glycoprotein, heat-resistant and acid, which is unstable at pH = 2. IFN- γ It can not only affect the cellular functions including anti-virus, anti swelling, cancer cell growth and differentiation, but also play an important role in immune regulation, such as promoting the synthesis of rRNA, promoting the expression of class I and class II histocompatibility antigens, and regulating the functional activity of homologous K cells, NK cells and macrophages. IFN- γ It also has antiviral activity, which is lower than type I, but it has strong immune regulation and anti cell proliferation, so it is also called immune interferon. |
Specifications Of P01I0345 Human Interferon gamma (IFNγ) Protein, Recombinant_copy20241119
| Product Information | |
Catalog Number | P01I0345 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | IFG; IFI; IMD69 |
Protein & NCBI Number | P01579、NM_000619.3 |
Host | E.coli |
Express Region | Met1-Gln166 |
Protein Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSD VADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFR GRRASQ |
Molecular Weight | The protein consists of 292 amino acids (including the fusion tag), with a predicted |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution. |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IFNG gene encodes a soluble cytokine that is a member of the type II interferon class. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. It has the functions of anti-virus, affecting cell growth and differentiation, anti-tumor, anti parasite and immune regulation. Interferon- γ (interferon-gamma, IFN- γ) It is a cytokine mainly secreted by activated T cells and NK cells under the stimulation of mitogen and specific antigen. It is also a soluble glycoprotein, heat-resistant and acid, which is unstable at pH = 2. IFN- γ It can not only affect the cellular functions including anti-virus, anti swelling, cancer cell growth and differentiation, but also play an important role in immune regulation, such as promoting the synthesis of rRNA, promoting the expression of class I and class II histocompatibility antigens, and regulating the functional activity of homologous K cells, NK cells and macrophages. IFN- γ It also has antiviral activity, which is lower than type I, but it has strong immune regulation and anti cell proliferation, so it is also called immune interferon. |
BlueGene Biotech Product Show
BlueGene Biotech Product Show_copy20241119
Related Products Of Human Interferon gamma (IFNγ) Protein, Recombinant
P01I0420 Human Long arginine 3-IGF-1 (IGF1-LR3) Protein,Recombinant
P01R0005 Human Receptor activator of nuclear factor kappa B ligand (RANKL) Protein, Recombinant
Related Products Of Human Interferon gamma (IFNγ) Protein, Recombinant_copy20241119
P01I0420 Human Long arginine 3-IGF-1 (IGF1-LR3) Protein,Recombinant
P01R0005 Human Receptor activator of nuclear factor kappa B ligand (RANKL) Protein, Recombinant
