Tumor necrosis factor alpha (TNF-α) can also be called DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha
Specifications Of P01T0008 Human Tumor necrosis factor alpha (TNF-α) Protein, Recombinant
| Product Information | |
catalog number | P01T0008 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha |
Protein & NCBI Number | P01375、NM_000594.4 |
Host | E.coli |
Express Region | Met1-Leu233 |
Protein Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPR |
Molecular Weight | The protein molecule consists of 238 amino acids (including the fusion tag), with a |
Fusion Tag | None |
Purity | ≥80% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution. |
Storage &Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
TNF-α (tumor necrosis factor) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. |
BlueGene Biotech Product Show
Related Products Of Human Tumor necrosis factor alpha (TNF-α) Protein,Recombinant
P01T0008 Human Tumor necrosis factor alpha (TNF-α) Protein, Recombinant
