Vascular Endothelial Growth Factor(VEGF165) can also be called VEGFA
Specifications Of P01V0016 Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant
| Product Information | |
catalog number | P01V0016 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | VEGFA |
Protein & NCBI | P15962-4, AAM03108.1 |
Host | 293T |
Express Region | Ala27-Arg191 |
Protein Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLV CRCDKPRR |
Molecular Weight | The protein molecule consists of 198 amino acids (including the fusion tag), |
Fusion Tag | 6×His (C-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution. |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of angiogenesis and vasculogenesis in both fetal and adult tissues. It is a member of the PDGF family, characterized by the presence of 8 conserved cysteine residues and a cysteine knot structure. VEGF165 appears to be the most abundant and effective isoform, followed by VEGF121 and VEGF189. VEGF binds to the type I transmembrane receptor tyrosine kinases VEGF R1 (also known as Flt-1) and VEGF R2 (Flk-1/KDR) on endothelial cells. While VEGF shows highest affinity for VEGF R1, VEGF R2 seems to be the principal mediator of VEGF's angiogenic activity. VEGF165 binds to the semaphorin receptor neuropilin-1 and promotes the formation of a complex with VEGF R2. VEGF is essential during embryogenesis, where it regulates the proliferation, migration, and survival of endothelial cells. In adults, VEGF primarily acts in wound healing and in the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels are associated with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. VEGF is induced by hypoxia and cytokines such as IL-1, IL-6, IL-8, oncostatin M (OSM), and TNF-alpha. |
BlueGene Biotech Product Show
Related Products Of Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant
P01E0032 Human Epidermal Growth Factor (EGF) Protein,Recombinant
P01F0003 Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant
